SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002085 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002085
Domain Number 1 Region: 30-547
Classification Level Classification E-value
Superfamily ALDH-like 3.4e-123
Family ALDH-like 0.000000715
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002085   Gene: ENSPPYG00000001799   Transcript: ENSPPYT00000002148
Sequence length 563
Comment pep:known chromosome:PPYG2:1:211453806:211485606:1 gene:ENSPPYG00000001799 transcript:ENSPPYT00000002148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPAPALRRALLSRPWTGAGLRWKHTSSLKVANEPVLAFTQGSPERDALQKALKDLKGQ
TEAIPCVVGDEEVWTSDVRYQVSPFNHGHKVAKFCYADKSLLNKAIEAALAARKEWDLKP
IADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYAVEL
EGQQPISMPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAML
ASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQ
NLDRFRTFPRLAGECGGKNFHFVHRSADVESVVSGTLRSAFEYGGQKCSACSRLYVPHSL
WPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFARIKKWLEHARSSPSLTILAGGK
CDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLTVYVYPDDKYKETLQLVDSTTSYGLTG
AVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYILR
WTSPQVIKETHKPLRDWSYAYMQ
Download sequence
Identical sequences H2N8U2
ENSPPYP00000002085 ENSPPYP00000002085 XP_009232640.1.23681 9600.ENSPPYP00000002085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]