SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002128 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002128
Domain Number 1 Region: 2-109
Classification Level Classification E-value
Superfamily POZ domain 5.34e-31
Family BTB/POZ domain 0.00042
Further Details:      
 
Domain Number 2 Region: 508-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.27e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 368-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 452-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.83e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 549-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.98e-17
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 6 Region: 325-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000368
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 7 Region: 581-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000753
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 302-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000791
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 9 Region: 414-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000208
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 10 Region: 720-747
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000891
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002128   Gene: ENSPPYG00000001833   Transcript: ENSPPYT00000002191
Sequence length 807
Comment pep:known_by_projection chromosome:PPYG2:1:214472092:214509110:1 gene:ENSPPYG00000001833 transcript:ENSPPYT00000002191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVV
HLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATS
PGGNAEALATEGGDKRAKEEKAATSTLSRLEQAGRSAPTGPSRDLKEERGGQAQSAASGA
EQTEKADAPREPLPVELKPDPTSGMAAAEAEAALSESSEQEMEVEPARKGEEEQEEQEEE
GAGPAEVKEEGSHLQNGEAPEENENEESAGTDSGQELGSEARGLRSGTYGDRTESKAYGS
VIHKCEDCGKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLKPYG
CEECGKSYRLISLLNLHKKRHSGEARYRCEDCGKLFTTSGNLKRHQLVHSGEKPYQCDYC
GRSFSDPTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECGKQF
TTSGNLKRHLRIHSGEKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQAS
SLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGDLSK
HIIIHTGEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGSEVSVVTVDDMV
TLATEALAATAVTQLTGPATLPAVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHIL
YACDSCGDKFLDANSLAQHVRIHTAQALVMFQTDADFYQQYGPGGTWPAGQVLQAGELVF
RPRDGAEGQPALAETSPTAPECPPPAE
Download sequence
Identical sequences H2N8Y5
9600.ENSPPYP00000002128 XP_002811479.1.23681 ENSPPYP00000002128 ENSPPYP00000002128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]