SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002140 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002140
Domain Number 1 Region: 7-266
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.2e-85
Family Eukaryotic proteases 0.000000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002140   Gene: ENSPPYG00000001846   Transcript: ENSPPYT00000002204
Sequence length 268
Comment pep:known_by_projection chromosome:PPYG2:1:215063085:215071434:-1 gene:ENSPPYG00000001846 transcript:ENSPPYT00000002204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGITVLAALLACASSCGVPSFPPNLSARVVGGESARPHSWPWQISLQYLKNDTWWHTCG
GTLIASNFVLTAAHCISNTRTYRVGVGKNNLEVEDEEGSLFVGVDTIYVHKKWNALLLRN
DIALIKLAEHVELSDTIQVACLPEKDSLLPKDYPCYVTGWGRLWTNGPIADELQQGLQPV
VDHATCSRIDWWGFSVKKTMVCAGGDGVISACNGDSGGPLNCQLENGSWEVFGIVSFGSR
QGCNTRKKPVVYTRVSAYIDWINEKTQL
Download sequence
Identical sequences H2N8Z7
9600.ENSPPYP00000002140 ENSPPYP00000002140 XP_002811497.1.23681 ENSPPYP00000002140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]