SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002193 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002193
Domain Number 1 Region: 419-657
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.22e-65
Family Eukaryotic proteases 0.0000000202
Further Details:      
 
Domain Number 2 Region: 34-144
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-30
Family Spermadhesin, CUB domain 0.000000547
Further Details:      
 
Domain Number 3 Region: 200-290
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-20
Family Spermadhesin, CUB domain 0.0000149
Further Details:      
 
Domain Number 4 Region: 295-364
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000032
Family Complement control module/SCR domain 0.0000629
Further Details:      
 
Domain Number 5 Region: 361-431
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000598
Family Complement control module/SCR domain 0.00000887
Further Details:      
 
Domain Number 6 Region: 145-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000136
Family EGF-type module 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002193   Gene: ENSPPYG00000001893   Transcript: ENSPPYT00000002260
Sequence length 658
Comment pep:known_by_projection chromosome:PPYG2:1:219310681:219332796:1 gene:ENSPPYG00000001893 transcript:ENSPPYT00000002260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGQLDGHTMRLLTLLGLLCGSVATPLGSKWPEPVFGRLASPGFPGEYANDQERRWTLTAP
PGYRLRLYFTHFDLELSHLCKYDFVKLSSGAKVLATLCGQESTDTERAPGNDTFYSLGSS
LDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYV
LHRNKRTCSVTQRSGLSSYPPYPKLSSCTYSIRLEEGSVILDFVESFDVETHETLCPYDF
LKIQTDREEHGPFCGKTLPHRIETKSNTVTVTFVTDESGEHTGWKIHYTSTAQPCPYPMA
PLNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDQPMPTCSIVD
CGPPDDLPRGRAEHITGPGVTTYKAVIQYSCEETFYTIKVNDGKYVCEADGFWTSSKGEK
SLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAV
YEQKHDASSLDIRMGALKRLSPHYTQAWAEAVFIHEGYTHDAGFDNDIALIKLNNKIVIN
SNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTAAYEKP
PYPGGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETQRWFVGGIVSWGSMNCGEA
Download sequence
Identical sequences H2N949
ENSPPYP00000002193 ENSPPYP00000002193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]