SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002234 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002234
Domain Number 1 Region: 26-139
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000127
Family Growth factor receptor domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000002234
Domain Number - Region: 135-158
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00273
Family TNF receptor-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002234   Gene: ENSPPYG00000001926   Transcript: ENSPPYT00000002301
Sequence length 254
Comment pep:known_by_projection chromosome:PPYG2:1:222531765:222551382:1 gene:ENSPPYG00000001926 transcript:ENSPPYT00000002301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSYYNMVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQR
TCDICRQCKGVFRTRKECSSTSNAECDCIPGFHCLGAGCSMCEQDCKQGQELTKKGCKDC
CFGTFNDQKRGVCRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSATPPAPARE
PGHSPQIISFFLALTSTALLFLLFFLMLRFFVVKRGRKKLLYIFKQPFMRPVQTTQEEDG
CSCRFPEEEEGCEL
Download sequence
Identical sequences H2N990
9600.ENSPPYP00000002234 ENSPPYP00000002234 XP_002811590.1.23681 ENSPPYP00000002234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]