SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002670 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002670
Domain Number 1 Region: 261-375
Classification Level Classification E-value
Superfamily C-type lectin-like 3.26e-32
Family C-type lectin domain 0.00000116
Further Details:      
 
Domain Number 2 Region: 220-258
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.0000000000000229
Family Triple coiled coil domain of C-type lectins 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002670   Gene: ENSPPYG00000002295   Transcript: ENSPPYT00000002759
Sequence length 375
Comment pep:known_by_projection chromosome:PPYG2:10:55352502:55364104:1 gene:ENSPPYG00000002295 transcript:ENSPPYT00000002759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFLLSALVLLTQPLGYLEAEMKTYSHRTTPSACTLVMCSSVESGLPGRDGRDGREGPR
GEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGRE
GPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLTGPKGERGVPGERGVPGNA
GAAGSAGAMGPQGSPGARGPPGLKGDKGVPGDKGAKGESGLPDVASLRQQVEALQGQVQH
LQAAFSQHKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLVCTQAGGQLASPRSAAENAAL
QQLVIAQNEAAFLGVTDSKTEGKFTYPTGESLDYSNWAPGEPNDDGGSEDCVEIFTNGKW
NDRACGEKRLVVCEF
Download sequence
Identical sequences H2NAF9
ENSPPYP00000002670 XP_002820814.1.23681 9600.ENSPPYP00000002670 ENSPPYP00000002670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]