SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002671 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002671
Domain Number 1 Region: 75-186
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-29
Family C-type lectin domain 0.00000274
Further Details:      
 
Domain Number 2 Region: 41-70
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.000085
Family Triple coiled coil domain of C-type lectins 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002671   Gene: ENSPPYG00000002296   Transcript: ENSPPYT00000002760
Sequence length 187
Comment pep:novel chromosome:PPYG2:10:55377671:55381092:-1 gene:ENSPPYG00000002296 transcript:ENSPPYT00000002760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGLRGLQGPPGKMGPPGNTGASGIPGPRGQKGDHGDNSVAEAKLANLERELRSLRSELDH
TKKLQAFSLGKMSGKKLFVTNGERMPFSKVKALCAGLQATVAAPKNAEENKAIQDVAKDT
AFLGITDEATEGQFMYVTGGRLTYSNWKKDEPNDHGSGEDCVILLNNGLWNDISCASSFI
AVCEFPA
Download sequence
Identical sequences H2NAG0
ENSPPYP00000002671 ENSPPYP00000002671 9600.ENSPPYP00000002671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]