SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002673 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002673
Domain Number 1 Region: 134-248
Classification Level Classification E-value
Superfamily C-type lectin-like 1.29e-30
Family C-type lectin domain 0.0000041
Further Details:      
 
Domain Number 2 Region: 104-129
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.0000000595
Family Triple coiled coil domain of C-type lectins 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002673   Gene: ENSPPYG00000002298   Transcript: ENSPPYT00000002762
Sequence length 248
Comment pep:novel chromosome:PPYG2:10:55542032:55545226:1 gene:ENSPPYG00000002298 transcript:ENSPPYT00000002762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLCPLALTLTLTAASGAACEVKDICVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPM
GPPGEMPCPPGNDGLPGAPGVPGKHGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQ
TRGALSLQGSIMTVGEKVFSTNGQSVTFDAIQEACARAGGRIAVPRNPEENEAIASFVKK
YNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLQ
YRLTICEF
Download sequence
Identical sequences H2NAG2
ENSPPYP00000002673 XP_002820820.1.23681 XP_002820821.2.23681 XP_009243698.1.23681 9600.ENSPPYP00000002673 ENSPPYP00000002673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]