SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002700 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002700
Domain Number 1 Region: 166-423
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.3e-81
Family Eukaryotic proteases 0.000000000772
Further Details:      
 
Domain Number 2 Region: 48-161
Classification Level Classification E-value
Superfamily Kringle-like 8.7e-32
Family Kringle modules 0.00000635
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002700   Gene: ENSPPYG00000002324   Transcript: ENSPPYT00000002791
Sequence length 431
Comment pep:known chromosome:PPYG2:10:61297436:61304090:-1 gene:ENSPPYG00000002324 transcript:ENSPPYT00000002791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQ
HCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLAWNSATVLQQTYHAHRSDALQLGLGKHN
YCRNPDNRWRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIV
GGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVVSATHCFIDYPKKEDYIVYLG
RSRLNSHTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIHSKEGRCAQPSRTIQTICL
PSMYNDPPFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKML
CAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSYFLPWIR
SHTKEENGLAL
Download sequence
Identical sequences Q5RF29
ENSPPYP00000002700 9600.ENSPPYP00000002700 ENSPPYP00000002700 NP_001124729.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]