SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002756 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002756
Domain Number 1 Region: 346-530
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.17e-29
Family Prokaryotic proteases 0.0025
Further Details:      
 
Domain Number 2 Region: 200-292
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000164
Family Prokaryotic proteases 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002756   Gene: ENSPPYG00000002375   Transcript: ENSPPYT00000002850
Sequence length 565
Comment pep:known_by_projection chromosome:PPYG2:10:65176464:65188593:1 gene:ENSPPYG00000002375 transcript:ENSPPYT00000002850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRQWGSAMRAAEQAGCVVSASRAGQPEAGPWSCSGVILSRSPGLVLCHGGIFVPFLRAG
SEVLTAAGAVFLPGDSCSDDLRLHVQWAPTAAGPGGGAERGRPGLCTPQCASLEPGPPAP
SRGCPLQRLPAELLLLLSCPAFWTHFARLFGDEAAEQWRFSSAARDDEVSEDEEADQLRA
LGWFALLGVRLGQEKVEEERGPAMAVSPLGAVPKGAPLLVCGSPFGAFCPDIFLNTLSCG
VLSNVAGPLLLTDARCLPGTEGGGVFTARPAGALVALVVAPLCWKAGEWVGFTLLCAAAP
LFRAARDALRRLPLSAAALAALLPPEVGVPWGLPLRDSGPPWAAAAVLVECGTVWGSGVA
VAPRLVVTCRHVSPREAARVLVRSTIPKSVAIWGCVVFATQETCPYDIAVVSLEEDLDDV
PIPVPAEHFHEGEAVSVVGFGIFGQACGPSVTSGILSAVVQVNGTPVMLQTTCAVHSGSS
GGPLFSNHSGNLLGIITSNTRDNNTGATYPHLNFSIPITVLQPALQQYSQTHDLGGLREL
DRAAEPVRVVWRLQRPLAEAPRSKL
Download sequence
Identical sequences H2NAN7
ENSPPYP00000002756 ENSPPYP00000002756 9600.ENSPPYP00000002756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]