SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002827 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002827
Domain Number 1 Region: 134-247
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-32
Family C-type lectin domain 0.000000802
Further Details:      
 
Domain Number 2 Region: 108-131
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.0000000000641
Family Triple coiled coil domain of C-type lectins 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002827   Gene: ENSPPYG00000002437   Transcript: ENSPPYT00000002927
Sequence length 248
Comment pep:novel chromosome:PPYG2:10:83569491:83575559:1 gene:ENSPPYG00000002437 transcript:ENSPPYT00000002927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLFPSLPLLLLSVVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKG
EPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDCDSSLAASERKALQTEMA
RIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRDAAENRAIRNLIKE
EAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDIPCSSSH
LAVCEFPI
Download sequence
Identical sequences H2NAV7 Q66S64
ENSPPYP00000002827 XP_002820974.1.23681 ENSPPYP00000002827 9600.ENSPPYP00000002827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]