SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002968 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002968
Domain Number 1 Region: 50-119
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000269
Family Viral proteases 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002968   Gene: ENSPPYG00000002556   Transcript: ENSPPYT00000003071
Sequence length 410
Comment pep:known chromosome:PPYG2:10:98715057:98735321:-1 gene:ENSPPYG00000002556 transcript:ENSPPYT00000003071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRLLFPPLRALKGRQYLPLLAPRAAPRAQCDCIRRPLRPGQYSTISEVALQSGRGTVSL
PSKAAERVVGRWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSQEEWEAE
FQRYQQFPEFKILNHDMTLTEFKFIWYMEYSHRMWGRLVGLVYILPAAYLWRKGWLSRGM
KGRVLALCGLVCFQGLLGWYMVKSGLEEKSDSHDIPRVSQYRLAAHLGSALVLYCASLWT
SLSLLLPPHKMPETRQLLQLRRFAHGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMGESW
IPEDLFTFSPILRNVFENPTMVQFDHRILGITSVTAITVLYFLSRRIPLPRRTKMAAVTL
LALAYTQVGLGISTLLMYVPTPLAATHQSGSLALLTGALWLMNELRRVPK
Download sequence
Identical sequences H2NB97
ENSPPYP00000002968 9600.ENSPPYP00000002968 ENSPPYP00000002968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]