SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003035 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000003035
Domain Number - Region: 189-252
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 0.0889
Family NAD-binding domain of HMG-CoA reductase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003035   Gene: ENSPPYG00000002609   Transcript: ENSPPYT00000003139
Sequence length 417
Comment pep:known_by_projection chromosome:PPYG2:10:101778596:101803090:1 gene:ENSPPYG00000002609 transcript:ENSPPYT00000003139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRDPRRSWNAFQILRFRFFERFSPVGLSSECTWVHLSTTSSFLDYWGSRPAGLPASREG
RPHPVYSHDYPVCSWSTVLYVSKMEADPSGFNIDAPRWDQRTFLGRVKHFLNITDPRTVF
VSERELDWAKVMVEKSRMGVVPPGTQVEQLLYAKKLYDSAFHPDTGEKMNVIGRMSFQLP
GGMILTGFMLQFYRTMPAVIFWQWVNQSFNALVNYTNRNAASPTSVRQMALSYFTATTTA
VATAVGMNMLTKKAPPLVGRWVPFAAVAAANCVNIPMMRQQELIQGICVKDRNENEIGHS
RRAAAIGITQVVISRITMSAPGMILLPVIMERLEKLHFMQKVKVLHAPLQVMLSGCFLIF
MVPVACGLFPQKCELPVSYLERKLQDTIKANSSSLSDFLFSYRQPLFWKCLEGMWWL
Download sequence
Identical sequences H2NBG2
ENSPPYP00000003035 ENSPPYP00000003035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]