SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003103 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003103
Domain Number 1 Region: 298-555
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.16e-76
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 174-281
Classification Level Classification E-value
Superfamily Kringle-like 1.67e-29
Family Kringle modules 0.0003
Further Details:      
 
Domain Number 3 Region: 73-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000583
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 113-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000221
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003103   Gene: ENSPPYG00000002662   Transcript: ENSPPYT00000003209
Sequence length 560
Comment pep:known_by_projection chromosome:PPYG2:10:112933051:112968567:1 gene:ENSPPYG00000002662 transcript:ENSPPYT00000003209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFARMSDLHVLLLMALVGKTACGFSLMSLLESLDPDWTPDQYDYSYEDYNQEENTSSTLT
HPENPDWYYTEDQADPCQPNPCEHSGECLVHGSTFTCSCLAPFSGNKCQKVQNTCKDNPC
GRGQCLITQSPPYYHCVCKHPYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKFTCACLD
QFKGKFCEIGSDDCYVGDGYSYRGKMNRTVNQHACLYWNSHLLLQENYNMFMEDAETHGI
GEHNFCRNPDADEKPWCFIKVTNDKVKWEYCDVSACSAQDVAYTEESPTEPSAKFLGFDS
CGKTEIAERKIKRVYGGFKSTAGKHPWQASLQSSLPLTVSMPQGHFCGGALIHPCWVLTA
AHCTDIKTRHLKVVLGDQDLKKEEFHEQSFRVEKIFKYSHYNERDEIPHNDIALLKLKPV
DGHCALESKYVKTVCLPDGSFPSGSECHISGWGVTETGKGSRQLLDAKVKLIANALCNSR
RLYDHMIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKDGTYYVYGIVSWGLECGTRPGVY
THVTKFLNWIKSTIKSESGF
Download sequence
Identical sequences H2NBM4
9600.ENSPPYP00000003103 XP_002821197.1.23681 ENSPPYP00000003103 ENSPPYP00000003103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]