SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003172 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003172
Domain Number 1 Region: 212-408
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.37e-57
Family Prokaryotic proteases 0.00000064
Further Details:      
 
Domain Number 2 Region: 423-519
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-22
Family HtrA-like serine proteases 0.0029
Further Details:      
 
Domain Number 3 Region: 77-164
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000832
Family Growth factor receptor domain 0.0011
Further Details:      
 
Domain Number 4 Region: 152-197
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000177
Family Ovomucoid domain III-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003172   Gene: ENSPPYG00000002716   Transcript: ENSPPYT00000003279
Sequence length 522
Comment pep:known_by_projection chromosome:PPYG2:10:122060255:122118241:1 gene:ENSPPYG00000002716 transcript:ENSPPYT00000003279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWAARPRALAPAAPEALPHSPRRRSPALALSAAAAAAARVAMQIPRAALLPLLLLLLAA
PASAQLSRAGRSAPLAAGCPERCEPARCPPQPEHCEGGRARDACGCCEVCGAPEGAACGL
QEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCGSDANTYANLCQLRAASRR
SERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKRE
VPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDH
EGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQ
TDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAIT
KKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPDTPAEAGGLKENDVIISIN
GQSVVSANDVSDVIKRESTLNMVVRRGNEDIMITVIPEEIDP
Download sequence
Identical sequences H2NBU2
XP_002821267.1.23681 ENSPPYP00000003172 ENSPPYP00000003172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]