SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003204 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003204
Domain Number 1 Region: 42-115
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 7.46e-19
Family Ribosomal protein L11, C-terminal domain 0.0045
Further Details:      
 
Domain Number 2 Region: 1-53
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 0.00000000000477
Family Ribosomal L11/L12e N-terminal domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003204   Gene: ENSPPYG00000002744   Transcript: ENSPPYT00000003312
Sequence length 132
Comment pep:novel chromosome:PPYG2:10:124507648:124508142:-1 gene:ENSPPYG00000002744 transcript:ENSPPYT00000003312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLAQIEVVPSASALIIKALKEPPRDRK
KQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIID
DINSGAVECPAS
Download sequence
Identical sequences H2NBX3
ENSPPYP00000003204 9600.ENSPPYP00000003204 ENSPPYP00000003204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]