SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003276 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003276
Domain Number 1 Region: 51-164
Classification Level Classification E-value
Superfamily C-type lectin-like 7.87e-33
Family C-type lectin domain 0.000000802
Further Details:      
 
Domain Number 2 Region: 25-47
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.00000000015
Family Triple coiled coil domain of C-type lectins 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003276   Gene: ENSPPYG00000002807   Transcript: ENSPPYT00000003384
Sequence length 165
Comment pep:novel chromosome:PPYG2:10_random:24261316:24263708:-1 gene:ENSPPYG00000002807 transcript:ENSPPYT00000003384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLRLVLNNASLLCSNFLDCDSSLAASERKALQTEMARIKKWLTFSLDKQVGNKFFLTNG
EIMTFEKVKALCVKFQASVATPRDAAENRAIRNLIKEEAFLGITDEKTEGQFVDLTGNRL
TYTNWNEGEPNNAGSDEDCVLLLKNGQWNDIPCSSSHLAVCEFPI
Download sequence
Identical sequences H2NC44
ENSPPYP00000003276 ENSPPYP00000003276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]