SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003452 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003452
Domain Number 1 Region: 34-417
Classification Level Classification E-value
Superfamily ALDH-like 2.62e-114
Family ALDH-like 0.00000000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003452   Gene: ENSPPYG00000002977   Transcript: ENSPPYT00000003575
Sequence length 447
Comment pep:known_by_projection chromosome:PPYG2:11:8103507:8115168:-1 gene:ENSPPYG00000002977 transcript:ENSPPYT00000003575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNELWKQALPEGGCALLPTLGILAHPDPTHFPQSAFESEVSEVAISQGEVTLALRNLRAW
MKDERVPKNLATQLDSAFIRKEPFGLVLIIAPWNYPLNLTLVPLVGALAAGNCVVLKPSE
ISKSVEKVLAEVLPRYLDQSCFAVVLGGPQETGQLLEHRFDYIFFTGSPRVGKIVMTAAA
KHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFRYFNAGQTCVAPDYILCSPEMQERLL
PALQSTITRFYGDDPQSSPNLGRIINQKQFQRLRALLGCGRVAIGGQSDESDRYIAPTVL
VDVQETEPVMQEEIFGPILPIVNVRSVDEAIEFINRREKPLALYAFSNSSQVVKRVLTQT
SSGGFCGNDGFMHMTLASLPFGGVGASGMGRYHGKFSFDTFSHHRSCLLRSPGMEKLNAL
RYPPQSPRRLRVLLVAMEARGCSCTLL
Download sequence
Identical sequences H2NCL7
XP_002821478.2.23681 ENSPPYP00000003452 ENSPPYP00000003452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]