SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003473 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003473
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily DNA clamp 3.31e-18
Family DNA polymerase processivity factor 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003473   Gene: ENSPPYG00000002996   Transcript: ENSPPYT00000003596
Sequence length 385
Comment pep:known_by_projection chromosome:PPYG2:11:8507947:8514356:-1 gene:ENSPPYG00000002996 transcript:ENSPPYT00000003596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQAATPGQDLLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRK
THNLSFQDCESLQAVFDPASCPHMLRAPARVLGEAVLPFPPALAEVTLGIGRGRRVILRS
YHEEEADSTAKAMVTEMCLGEEDFQQLQAQEGVAITFCLKEFRGLLSFAESANLNLSIHF
DAPGRPAIFTIKDSLLDGHFVLATLSDTDSHSQDLGPERHQAVPQLQAHSIPHPDDFAND
DIDSYMIAMETTIGNEGSRVLPSISLSPGPQPPKSPGPHSEEEDEAEPSTVPGTPPPKKF
RSLFFGSILALYAPPKGPSPVLAEE
Download sequence
Identical sequences H2NCN7
9600.ENSPPYP00000003473 ENSPPYP00000003473 ENSPPYP00000003473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]