SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003502 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003502
Domain Number 1 Region: 17-83
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 3.66e-24
Family Ribosomal L11/L12e N-terminal domain 0.00032
Further Details:      
 
Domain Number 2 Region: 80-155
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 2.88e-17
Family Ribosomal protein L11, C-terminal domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003502   Gene: ENSPPYG00000003025   Transcript: ENSPPYT00000003628
Sequence length 192
Comment pep:known_by_projection chromosome:PPYG2:11:9502379:9506250:1 gene:ENSPPYG00000003025 transcript:ENSPPYT00000003628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKLGRATRGLRKPEVGGVIRAIVRAGLAMPGPPLGPALGQRGVSINQFCKEFNEKTKDI
KEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEI
ACIKAQDEAFTLQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERAIFLAAQKE
ADLAAQEEAAKK
Download sequence
Identical sequences H2NCR6
XP_002821520.1.23681 ENSPPYP00000003502 9600.ENSPPYP00000003502 ENSPPYP00000003502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]