SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003623 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003623
Domain Number 1 Region: 101-502
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.06e-51
Family Glycerol-3-phosphate transporter 0.023
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000003623
Domain Number - Region: 40-73
Classification Level Classification E-value
Superfamily Kringle-like 0.0754
Family Kringle modules 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003623   Gene: ENSPPYG00000003137   Transcript: ENSPPYT00000003752
Sequence length 542
Comment pep:known chromosome:PPYG2:11:13132778:13159662:1 gene:ENSPPYG00000003137 transcript:ENSPPYT00000003752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFSEILDRVGSMGRFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPPNASTGPW
VLPMGPNGKPERCLRFVHPPNASLPNETQRATEPCLDGWVYNSTKDSIVTEWDLVCNSNK
LKEMAQSIFMAGILIGGLVLGDLSDRFGRRPILTCSYLLLAASGSGAAFSPTFPIYMVFR
FLCGFGISGITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFILPGLAYAIPQWRWLQL
TVSIPFFIFFLSSWWTPESIRWLVLSGKSSKALKILRRVAAFNGKKEEGERLSLEELKLN
LQKEIALAKAKYTASDLFRIPMLRRMTFCLSLAWFATGFAYYSLAMGVEEFGVNLYILQI
IFGGVDVPAKFITILSLSYLGRHTTQAAALLLAGGAILALTFVPLDLQTVRTVLAVFGKG
CLSSSFSCLFLYTSELYPTVIRQTGMGVSNLWTRVGSMLSPLVKITGEVQPFIPNIIYGI
TALLGGSAALFLPETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLG
SS
Download sequence
Identical sequences H2ND29
XP_009244496.1.23681 ENSPPYP00000003623 ENSPPYP00000003623 9600.ENSPPYP00000003623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]