SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003650 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003650
Domain Number 1 Region: 218-387,431-449,483-745
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.61e-44
Family Quinoprotein alcohol dehydrogenase-like 0.032
Further Details:      
 
Domain Number 2 Region: 696-840
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000439
Family WD40-repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003650   Gene: ENSPPYG00000003160   Transcript: ENSPPYT00000003779
Sequence length 868
Comment pep:known_by_projection chromosome:PPYG2:11:13562861:13572912:1 gene:ENSPPYG00000003160 transcript:ENSPPYT00000003779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELVKAALAEALRLLRLQVPRSSLQGSGTPAPPGDSSLAAPPGLPPTCTPSLVSRGTQTE
TEVELKSSPGPPGLSNGPPAPQGASEEPSGTQSEGGGSSSSGAGSPGPPGILRPLQPPQR
ADTPRRNSSSSSSPSERPRQKLSRKAISSANLLVRSGSTESRGGKDPLSSPGGPGSRRSN
YNLEGISVKMFLRGRPITMYIPSGIRSLEELPSGPPPETLSLDWVYGYRGRDSRSNLFVL
RSGEVVYFIACVVVLYRPGGGPGGPGGGGQRHYRGHTDCVRCLAVHPDGVRVASGQTAGV
DKDGKPLQPVVHIWDSETLLKLQEIGLGAFERGVGALAFSAADQGAFLCVVDDSNEHMLS
VWDCSRGMKLAEIKSTNDSVLAVGFNPRDSSCIVTSGKSHVHFWNWSGGVGVPGNGTLTR
KQGVFGKYKKPKFIPCFVFLPDGDILTGDSEGNILTWGRSPSDSKTPGRGGAKETYGIVA
QAHAHEGSIFALCLRRDGTVLSGGGRDRRLVQWGPGLVALQEAEIPEHFGAVRAIAEGLG
SELLVGTTKNALLRGDLAQGFSPVIQGHTDELWGLCTHPSQNRFLTCGHDRQLCLWDGES
HALAWSIDLKETGLCADFHPSGAVVAVGLNTGRWLVLDTETREIVSDVIDGNEQLSVVRY
SPDGLYLAIGSHDNVIYIYSVSSDGAKSSRFGRCMGHSSFITHLDWSKDGNFIMSNSGDY
EILYWDVAGGCKQLKNRYESRDREWATYTCVLGFHVYGVWPDGSDGTDINSLCRSHNERV
VAVADDFCKVHLFQYPCARAKAPSRMYGGHGSHVTSVRFTHDDSHLVSLGGKDASIFQWR
VLGAGGAGPAPATPSRTPSLSPASSLDV
Download sequence
Identical sequences H2ND55
ENSPPYP00000003650 ENSPPYP00000003650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]