SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003727 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003727
Domain Number 1 Region: 329-491,528-602
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.33e-30
Family Prokaryotic proteases 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003727   Gene: ENSPPYG00000003241   Transcript: ENSPPYT00000003864
Sequence length 610
Comment pep:known_by_projection chromosome:PPYG2:11:17467702:17472328:-1 gene:ENSPPYG00000003241 transcript:ENSPPYT00000003864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCKKQRSRKHSVNEKCNTKIEHYFSPVSKEQQNNSSTSLMKMESRGGPRAIINTQAQRF
HSPKKNPEDQTVPQNRIILVTLDVNHRKNQNMKHELTHSENGSLYMALNTLQAVRKEIET
HQGQEMLVRGTEGIKAYINLGMPLSCFPESCHVVITFPQSKSKQEEDNHVFGRHDKALTE
CVKFYIHAIGIGKYRRIVKCGKLHKKGCKLCVYAFKGETIKDALCKDGRFLLFLESDDWK
LIENNDSILESTQPVDELEGKHFQVEVEKRMVPSAAASQNLESEKRNTGVLREQVVAQYP
SLKRESEKIKENLKKKMKAKTGETLYNLHRTTFGKVTKNSSSIKVVKLLARLSDSVGYLF
WNSATTGCATCFVFKQLFILTCRHVIDDIVGDGIEPSKWATIIGQCVRVTFGYEELKDKE
TNYFFVEPWFEIHNEELDYAVLKLKENGQQVPMELYNGITPVPLSGLIHIIGHPYGEKKQ
IDACAVIPQGQRAKKCQERVQSKKAENPEYVHMYTQRSFQKIVQNPDVITYDTEFFFGTS
GSPVFDSNGSLVAMHAAGFAYTYQNQIRSIIEFGSTMESILLDIKQRHKPWYEEVFISQQ
DVEMMSDEDL
Download sequence
Identical sequences H2NDC9
9600.ENSPPYP00000003727 ENSPPYP00000003727 ENSPPYP00000003727 XP_009244585.1.23681 XP_009244586.1.23681 XP_009244587.1.23681 XP_009244588.1.23681 XP_009244589.1.23681 XP_009244590.1.23681 XP_009244591.1.23681 XP_009244592.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]