SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003763 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003763
Domain Number 1 Region: 109-221
Classification Level Classification E-value
Superfamily C-type lectin-like 7.35e-29
Family C-type lectin domain 0.000000655
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003763   Gene: ENSPPYG00000003275   Transcript: ENSPPYT00000003904
Sequence length 222
Comment pep:known_by_projection chromosome:PPYG2:11:19502344:19504842:1 gene:ENSPPYG00000003275 transcript:ENSPPYT00000003904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEW
GSGSEDASKEDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFNQ
AWFTCRRCYRGNLVSIHNFNTNYRIQCSVSVLNQGQIWIGGRITGSGRCRRFQWVDGSRW
NFAYWATRQPWSHGGHCVALCTRGGHWRRTHCLRRLPFICSY
Download sequence
Identical sequences H2NDG5
ENSPPYP00000003763 ENSPPYP00000003763 9600.ENSPPYP00000003763 XP_003777815.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]