SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003764 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003764
Domain Number 1 Region: 112-224
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-27
Family C-type lectin domain 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003764   Gene: ENSPPYG00000003276   Transcript: ENSPPYT00000003905
Sequence length 225
Comment pep:known_by_projection chromosome:PPYG2:11:19512097:19515933:1 gene:ENSPPYG00000003276 transcript:ENSPPYT00000003905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRLLLLPALLLGTVSALHLENDVPHLESLETQADLGQDLDSSKEQERDLALTEEVIQAE
GEEVKASACQDTFEDEEAMESDPAALDKGFQCPREEDIVEVQGSPRCKTCHYLLVRTPTT
FAKAQNVCRRCYRGNLVSIHNFSFNYRIQCCTSTVNQAQVWIGGILRGWFLWKRFCWTDG
SHWNFAYWSPGQPRNGRGCCVALCTKGGYWRRARCKKKLPFVCSF
Download sequence
Identical sequences H2NDG6
ENSPPYP00000003764 XP_002821833.1.23681 9600.ENSPPYP00000003764 ENSPPYP00000003764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]