SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003852 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003852
Domain Number 1 Region: 409-715
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.91e-54
Family Eukaryotic proteases 0.00054
Further Details:      
 
Domain Number 2 Region: 123-239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-33
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 3 Region: 297-366
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000973
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 234-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000431
Family EGF-type module 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003852   Gene: ENSPPYG00000003356   Transcript: ENSPPYT00000004000
Sequence length 715
Comment pep:known chromosome:PPYG2:11:33771280:33870409:1 gene:ENSPPYG00000003356 transcript:ENSPPYT00000004000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGCWTQLGLTFLQLLLISSLPREYTVINEACPGAEWNIMCRECCEYDQIECVCPGKKE
VVGYTIPCCRNEENECDSCLIHPGCTIFENCKSCRNGSWGGTLDDFYVKGFYCAECRAGW
YGGDCMRCGQVLRAPKGQILLESYPLNAHCEWTIHAKPGFVIQLRFVMLSLEFDYMCQYD
YVEVRDGDNRDGQIIKRVCGNERPAPIQSTGSSLHVLFHSDGSKNFDGFHAIFEEITACS
SSPCFHDGTCVLDKAGSYKCACLAGYTGQRCENLLEAGKSKIKASEDSLSVLEERNCSDP
GGPVNGYQKITGGPGLINGRHAKIGTVVSFFCNNSYVLSGNEKRTCQQNGEWSGKQPICI
KRETPLHQLYSAAFSKEKLQSAPTKKPALPFGDLPMGYQHLHTQLQYECISPFYRRLGSS
RRTCLRTGKWSGQAPSCIPICGKIENVTAPKTQGLRWPWQAAIYRRTSGVHDGSLHKGAW
FLVCSGALVNERTVVVAAHCVTDLGKVTMIKTADLKVVLGKFYRDDDRDEKTTQSLRISA
IILHPNYDPILLDADIAILKLLDKARISTRVQPICLAASRDLSTSFQESHITVAGWNVLA
DVRSPGFKNDTLRSGVVSVVDSLLCEEQHEDHGIPVSVTDNMFCASQDPTAPSDICTAET
GGIAAVSFPGRASPEPRWHLMGLVSWSYDKTCSHRLSTAFTKVLPFKDWIERNMK
Download sequence
Identical sequences H2NDP6
9600.ENSPPYP00000003852 ENSPPYP00000003852 ENSPPYP00000003852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]