SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003856 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003856
Domain Number 1 Region: 12-157
Classification Level Classification E-value
Superfamily C-type lectin-like 3.53e-53
Family Link domain 0.0000000806
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003856   Gene: ENSPPYG00000003358   Transcript: ENSPPYT00000004004
Sequence length 351
Comment pep:known_by_projection chromosome:PPYG2:11:34078843:34135114:-1 gene:ENSPPYG00000003358 transcript:ENSPPYT00000004004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKNLTFLFLPIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKAL
SIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCT
SVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTS
GGYIFYTFSTVHPIPDEDGPWITDSTDRTPATRDQDAFRPSGGSHTTHGSESAGHSHGSQ
EGGENTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAV
EDRKPSGLNGEASKSQEMVHLVNKESSETPDQFMTADETRNLQNVDMKIGV
Download sequence
Identical sequences H2NDQ0
ENSPPYP00000003856 ENSPPYP00000003856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]