SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003895 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003895
Domain Number 1 Region: 312-410
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000000135
Family Ricin B-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003895   Gene: ENSPPYG00000003393   Transcript: ENSPPYT00000004043
Sequence length 533
Comment pep:novel chromosome:PPYG2:11:38176608:38470090:1 gene:ENSPPYG00000003393 transcript:ENSPPYT00000004043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRQASISCAQGILLPQPSKLLRLQLNLVMNEQKEKITEKVILSMTAKEHHKEQEEVSR
LIDELKTAIKSNRGHLCKLGPQLQAEQEQFSSYVYQHIKSLPANMLVPGGLQLKVFENGK
NTGEISVGISKKDLGSDSPIQTDHMMERLLLKIHQRLQGSSINPPGLNFSSMRLFDENGQ
EIKNPLSLKNEQKIWVSYGRPYRSPLNLALGLTFDRVSAFARGDIMVAYKTFLDPNAVLL
PGCGNWEVCEGFPINFNCTSQQIPDQFEKVDLENHFLQNKVDPNIVLHASVSIGKWSFSG
SEASSRSQTAPSILWPVASVWLITKTGMILSRAITQGCLAIGHPIRVKAAEGTSLEGYKL
ILQKRHIGDESQKWVFGTDGCIYSKAYPQFVLTYLEELNSQVDVTQTEYHIHHGAWTTAH
QEHGRNLAEEVLQESASNPGLKQLPEPSDTHLMPEGSLEETGQLTVALVRKLEEKHPKAS
AQRWAIKHEGTSKPGQWKHSRVENPLWNKLTYMWPVLPSGQLNEAMQTEQGRR
Download sequence
Identical sequences H2NDT5
9600.ENSPPYP00000003895 ENSPPYP00000003895 ENSPPYP00000003895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]