SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003896 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003896
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily Doublecortin (DC) 3.14e-18
Family Doublecortin (DC) 0.01
Further Details:      
 
Domain Number 2 Region: 486-564
Classification Level Classification E-value
Superfamily Doublecortin (DC) 0.000000000000235
Family Doublecortin (DC) 0.0058
Further Details:      
 
Domain Number 3 Region: 238-343
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00000000178
Family Ricin B-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003896   Gene: ENSPPYG00000003394   Transcript: ENSPPYT00000004044
Sequence length 648
Comment pep:novel chromosome:PPYG2:11:38482020:38520353:1 gene:ENSPPYG00000003394 transcript:ENSPPYT00000004044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKPICKTTEPYAPVRLRVLRNGDNNKNRSVTILGPDISPGRKTQCTEILNLPSAARRLY
SEKGKEIFALKDLQRDELVYVSCGEHWINPDLSVAQQKKQIFLRNLESDIAKIQIFCCTH
KIEALVLEVQSDIVSGSKLAVHKPVAIFGEEKQVTEPEEKQMQEDALTMENASGEILDSH
ARAHLRMKACHTLLRYAWQETSHDFDEDDSLPKKMEKGLFENVEPQKKHSCSPKHSKLHK
HYHQQFEYRDGQIISHAAPQLVLGVQGPNLRSGMEVVLVEKKSDGSHQRWIYQEESRTFH
LVSNPDLVLAVSMTKTRNEVCGYPVIVQKYKPYNNGAANQKWHYMKNIKALVAFHSTALD
KEITSANYAGVCTSSVIKEENIDQPGYCYLSPDGKRKTMLCLACGQSMRTEKGLKQLLPG
VPFLCISGTKTQKPFLRGPFKVISVAEVDLSCDKAEKTLSYYQAHLLSLRMKTCTQAASH
SGMAATHQKAVKIIAYKNGDGYRNGKLIVAGTFPMLLTECTEQLGLARAASKVYTKDGTP
IFTLRDLVLWALDESFLQRDSEKQKQDAAPVGKEQIIVEKNPRMKVKNRLFAKSVTSDSL
DGIDKSLLTVILRNPIAIWVSCGEPFLPPNESRKIRETELAKKGQNFG
Download sequence
Identical sequences H2NDT6
ENSPPYP00000003896 ENSPPYP00000003896 9600.ENSPPYP00000003896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]