SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003998 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003998
Domain Number 1 Region: 133-460
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.5e-54
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000237
Further Details:      
 
Domain Number 2 Region: 464-600
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.29e-20
Family Ricin B-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003998   Gene: ENSPPYG00000003481   Transcript: ENSPPYT00000004151
Sequence length 607
Comment pep:known_by_projection chromosome:PPYG2:11:58571227:58939908:1 gene:ENSPPYG00000003481 transcript:ENSPPYT00000004151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCTRKTKTLVSTCVILSGMTNIICLLYVGWVTNYIASVYVRGQEPAPDKKLEEDKGDTL
KIIERLDHLENVIKQHIQEAPAKPEEAEAEPFTDSSLFAHWGQELSPEGRRVALKQFQYY
GYNAYLSDRLPLDRPLPDLRPSGCRNLSFPDSLPEVSIVFIFVNEALSVLLRSIHSAIER
TPPHLLKEIILVDDNSSNEELKEKLTEYVDKVNSQKPGFIKVVRHSKQEGLIRSRVSGWR
AATAPVVALFDAHVEFNVGWAEPVLTRIKENRKRIISPSFDNIKYDNFEIEEYPLAAQGF
DWELWCRYLNPPKAWWKLENSTAPIRSPALIGCFIVDRQYFQEIGLLDEGMEVYGGENVE
LGIRVWQCGGSVEVLPCSRIAHIERAHKPYTEDLTAHVRRNALRVAEVWMDEFKSHVYMA
WNIPQEDSGIDIGDITARKALRKQLQCKTFRWYLVTVYPEMRMYSDIIAYGVLQNSLKTD
LCLDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHVGILSPTVDDDDNRCLVDVNSRPRL
IECSYAKAKRMKLHWQFSQGGPIQNRKSKRCLELQENSDLEFGFQLVLQKCSGQHWSITN
ILRSLAS
Download sequence
Identical sequences H2NE34
ENSPPYP00000003998 ENSPPYP00000003998 9600.ENSPPYP00000003998 XP_002822072.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]