SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004003 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004003
Domain Number 1 Region: 29-178
Classification Level Classification E-value
Superfamily C-type lectin-like 1.58e-38
Family Link domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004003   Gene: ENSPPYG00000003488   Transcript: ENSPPYT00000004158
Sequence length 193
Comment pep:known_by_projection chromosome:PPYG2:11:59663516:59671576:1 gene:ENSPPYG00000003488 transcript:ENSPPYT00000004158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANLQLNFTEAKEA
CRLLGLTLASKDQVETALKASFETCSYGWVGDGFLVISRISPNPKCGKNGVGVLIWKVPV
SRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATHTTEFIVRNSTYSVASPYSTIPS
GTITPPAPASTSI
Download sequence
Identical sequences H2NE39
ENSPPYP00000004003 9600.ENSPPYP00000004003 ENSPPYP00000004003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]