SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004035 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004035
Domain Number 1 Region: 15-299
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.48e-81
Family Eukaryotic proteases 0.00057
Further Details:      
 
Domain Number 2 Region: 431-543
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.22e-29
Family Spermadhesin, CUB domain 0.00085
Further Details:      
 
Domain Number 3 Region: 318-420
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-23
Family Spermadhesin, CUB domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004035   Gene: ENSPPYG00000003517   Transcript: ENSPPYT00000004192
Sequence length 564
Comment pep:known_by_projection chromosome:PPYG2:11:62712904:62728463:1 gene:ENSPPYG00000003517 transcript:ENSPPYT00000004192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLISRIKLILLLGIAFFEPRKSATFSLPKAPSCGQSLVKVQPWNYFNIFSRILGGSQVEK
GSYPWQVSLKQRQKHICGGSIVSPQWVITAAHCVANRNIVSTLNVTAGEYDLSQTEPGEQ
TLTIETVIIHPHFSTKKPMDYDIALLKMAGAFQFDHFVGPICLPELREQFEAGFICTTAG
WGRLTEGGILSQVLQEVNLPILTWEECVAALLTLKRPISGKTFLCTGFPDGGRDACQGDS
GGSLMCRNKKGDWTLAGVTSWGLGCGRGWRNNVRKNDQGSPGIFTDLSKVLPWIHEHIQT
GNRRKSSRAWCSEQDVIVSGAEGELHFPESLHLYYESKQRCVWTLLVPEGMHVLLSFSHL
DVESCHHNYLSMYSLEDRPIGKFCGESLPSSILVGSNSLRLKFISDATDYAAGFNLTYKA
LKPNYIPDSGCSYLTVLFEEGLIQSLNYPENYSDKANCDWIFQAPKHHLIKLSFQSLEIE
ESGDCTSDYVTVHSDVERKKEIARLCGYDVPTPVLSPSSIMLISFQSDENGTFRGFQATV
SFIPKAGKKIESRTLWFPVLILVM
Download sequence
Identical sequences H2NE71
9600.ENSPPYP00000004035 ENSPPYP00000004035 ENSPPYP00000004035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]