SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004239 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004239
Domain Number 1 Region: 40-267
Classification Level Classification E-value
Superfamily Aquaporin-like 4.19e-35
Family Aquaporin-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004239   Gene: ENSPPYG00000003711   Transcript: ENSPPYT00000004412
Sequence length 271
Comment pep:known_by_projection chromosome:PPYG2:11:73082691:73100212:1 gene:ENSPPYG00000003711 transcript:ENSPPYT00000004412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPLLGLRPELQDTCTSLGLMLSVVLLMGLARVVARQQLHRPVAHAFVLEFLATFQLCCC
THELQLLSEQHPAHPTWTLTFVYFFSLVHGLTLVGTSSNPCGVMMQMMLGGMSPETGAVR
LLAQLVSALCSRYCTSALWSLGLTQYHVSERSFACKNPIQVDLLKAVITEAVCSFLFHSA
LLHFQEVRTKLRIHLLAALITFLVYAGGSLTGAVFNPALALSLHFMCFDEAFPQFFIVYW
LAPSLGILLMILMFSFFLPWLHNNHTINKKE
Download sequence
Identical sequences H2NER5
ENSPPYP00000004239 ENSPPYP00000004239 XP_002822323.1.23681 9600.ENSPPYP00000004239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]