SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004405 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004405
Domain Number 1 Region: 93-157
Classification Level Classification E-value
Superfamily E set domains 0.0000701
Family Filamin repeat (rod domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004405   Gene: ENSPPYG00000003847   Transcript: ENSPPYT00000004580
Sequence length 532
Comment pep:known_by_projection chromosome:PPYG2:11:105093824:105164968:-1 gene:ENSPPYG00000003847 transcript:ENSPPYT00000004580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFRSSFASLFSFRKSGKETSKLPSLGQKGCDGHAGPPMPVRGAAVQAKIYNSSLENQLV
DSTFVPKPAVMREDSGMPPPWDASLLENEFFQGQTPFKVVVKSLSPKELVRIHVPKPLDR
NDGTFLMRYRMYETVDEGLKIEVLYGDKHVAQSPYILKGPVYHEYCECPEDPQAWQKTLS
CPTREPQITKDFASFPSINLQQMLNEVPKRFGDERGAIVHYTILNNHIYRRSLGKYTDFK
MFSDEILLSLTRKVLLPDLEFYVNLGDWPLEHRKVNGTPSPIPVISWCGSLDSRDVVLPT
YDITHSMLEAMRGVTNDLLSIQGNTGPSWINKTERAFFRGRDSREERLQLVQLSKENPQL
LDAGITGYFFFQEKEKELGKAKLMGFFDFFKYKYQVNVDGTVAAYRYPYLMLGDSLVLKQ
DSPYYEHFYMALEPWKHYVPIKRNLSDLLEKVKWAKENDEAAKKIAKEGQLMARDLLQPH
RLYCYYYQVLQKYAERQSSKPKVRDGMELIPQPEDSTAICQCHRKKPSREEL
Download sequence
Identical sequences H2NF76
ENSPPYP00000004405 ENSPPYP00000004405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]