SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004490 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004490
Domain Number 1 Region: 274-476
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.39e-74
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 2 Region: 184-280
Classification Level Classification E-value
Superfamily SRCR-like 1.19e-18
Family Hepsin, N-terminal domain 0.018
Further Details:      
 
Domain Number 3 Region: 163-187
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000916
Family LDL receptor-like module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004490   Gene: ENSPPYG00000003919   Transcript: ENSPPYT00000004666
Sequence length 484
Comment pep:known_by_projection chromosome:PPYG2:11:114828568:114855085:-1 gene:ENSPPYG00000003919 transcript:ENSPPYT00000004666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERDSHGNASPARTPSAGESPAQASPAGTPPGRASPAQASPARASPAQASPALASPSRSS
SGRSSSARSASVTTSPTRVYLVRATPVGAVPVRSSPARSAAAARATRESPGTSLPKFTWR
EGQKRLPLIGCVLLLIALVVSLIILFQFWRGHTGIRYKEQRESCPKHAVRCDGVVDCKLK
SDELGCVRFDWDKSLLKIYSGSSHQWLPICSSNWNDSYSEKTCQQLGFKSAYRTTEVAHR
DFANSFSILRYNSTIQESLHRSECPSQRYISLQCSHCGLRAMTGRIVGGALASDSKWPWQ
VSLHFGTTHICGGTLIDAQWVLTAAHCFFVTREXXXXINSNYTDEEDDYDIALMRLSKPL
TLSAHIHPACLPMHGQTFSLNETCWITGFGKTRETDECNDYVYDSYLTPRMMCAGDLRGG
RDSCQGDSGGPLVCEQNNRWYLAGVTSWGTGCGQRNKPGVYTKVTEVLPWIYSKMESEVR
FRKS
Download sequence
Identical sequences H2NFF6
ENSPPYP00000004490 ENSPPYP00000004490 9600.ENSPPYP00000004490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]