SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004493 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004493
Domain Number 1 Region: 192-434
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.37e-84
Family Eukaryotic proteases 0.00022
Further Details:      
 
Domain Number 2 Region: 101-199
Classification Level Classification E-value
Superfamily SRCR-like 6.93e-16
Family Hepsin, N-terminal domain 0.039
Further Details:      
 
Domain Number 3 Region: 54-93
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004493   Gene: ENSPPYG00000003922   Transcript: ENSPPYT00000004669
Sequence length 437
Comment pep:known_by_projection chromosome:PPYG2:11:115008553:115048940:1 gene:ENSPPYG00000003922 transcript:ENSPPYT00000004669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQDPDSDQPLNSLDVKPLRKPRTPMETFRKVGIPIIIALLSLASIIIVVVLIKVILDKY
YFLCGQPLHFIPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDPAT
GNWFSACFDNFTEALAETACRQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELHVRNSS
GPCLSGSLVSLHCLACGESLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGSILDPHWI
LTAAHCFRKHTDVFNWKVQAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPL
TFSGAVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSIRCNADD
AYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWQVVGIVSWGYGCGGPSTPGVYT
KVSAYLNWIYNVWKAEL
Download sequence
Identical sequences H2NFF9
9600.ENSPPYP00000004493 ENSPPYP00000004493 ENSPPYP00000004493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]