SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004647 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004647
Domain Number 1 Region: 593-854
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.77e-90
Family Eukaryotic proteases 0.00000000376
Further Details:      
 
Domain Number 2 Region: 339-446
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-29
Family Spermadhesin, CUB domain 0.00085
Further Details:      
 
Domain Number 3 Region: 227-332
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-19
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 4 Region: 87-170
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000536
Family SEA domain 0.01
Further Details:      
 
Domain Number 5 Region: 525-559
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 453-488
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 491-525
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 8 Region: 564-604
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000014
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004647   Gene: ENSPPYG00000004066   Transcript: ENSPPYT00000004829
Sequence length 855
Comment pep:known_by_projection chromosome:PPYG2:11:127324606:127381959:1 gene:ENSPPYG00000004066 transcript:ENSPPYT00000004829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSDRARKGGGGPKDFGAGLKYSSRHEKVNGLEEGVEFLPVNNVKKVEKHGPGRWVVLAA
VLIGLLLVSLGIGFLVWHLQYRDVRVQKVFNGYMRITNENFVDAYENSNSTEFVSLASKV
KDALKLLYSGVPFLGPYHKESAVTAFSEGSVIAYYWSEFSIPQHLVEEAERVMAEERVVM
LPPRARSLKSFVVTSVVAFPTDPKTVQRTQDNSCSFALHARGVELMRFTTPGFPDSPYPA
HARCQWALRGDADSVLSLTFRSFDLASCDERGSDLVMVYNTLSPMEPHALVQLCGTYPPS
YNLTFHSSQNVLLITLITNTERRHPGFEATFFQLPKMGSCGGRLRKAQGTFNSPYYPGHY
PPNIDCTWNIEVPNNQHVKVRFKFFYLLEPGVPTGTCPKDYVEINGEKYCGERSQFVVTS
NSNKITVRFHSDQSYTDTGFLAEYLSYDSSDPCPGQFTCRTGRCIRKELRCDGWADCTDH
SDELNCSCDASHQFTCKNKFCKPLFWVCDSVNDCGDNSDEQGCSCPAQTFRCSNGKCLSK
SQQCNGKDDCGDGSDEVSCAKVNVVTCTKHTYRCLNGLCLSKGNPECDGKEDCSDGSDEK
DCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYID
DRGFRYSDPTQWTAFLGLHDQSQRSAPEVQERRLKRIISHPFFNDFTFDYDIALLELEKP
AEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYAGTGALILQKGEIRVINQTTCENLL
PQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYT
RLPLFRDWIKEKTGV
Download sequence
Identical sequences H2NFW2
9600.ENSPPYP00000004647 ENSPPYP00000004647 XP_002822743.1.23681 ENSPPYP00000004647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]