SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004756 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004756
Domain Number 1 Region: 160-486
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 6.05e-59
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000327
Further Details:      
 
Domain Number 2 Region: 491-625
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.32e-18
Family Ricin B-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004756   Gene: ENSPPYG00000004172   Transcript: ENSPPYT00000004944
Sequence length 637
Comment pep:known_by_projection chromosome:PPYG2:12:4843817:4904066:1 gene:ENSPPYG00000004172 transcript:ENSPPYT00000004944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMFWRKLPKALCIGLTLAIAVNLLLVFSSKGTLQNLFTGGLHRELPLHLNKRDGAVIKRL
SHLEVELQDLKESMKLALRQQENVNNTRKRAKDEVRPVLKAMETKVNEAKKHKTQMKLFP
HSQLFRQWGEDLSEAQQKAAQDLFRKFGYNAYLSNQLPLNRTIPDTRDYRCLRKTYPSQL
PSLSVILIFVNEALSIIQRAITSIINRTPSRLLKEIILVDDFSSNGELKVHLDEKIKLYN
QKYPGLLKIIRHPERKGLAQARNTGWEAATADVVAILDAHIEVNVGWAEPILARIQEDRT
VIVSPVFDNIRFDTFKLDKYELAVDGFNWELWCRYDALPQAWIDVHDVTAPVKSPSIMGI
LAANRHFLGEIGSLDGGMLIYGGENVELSLRVWQCGGRIEILPCSRIAHLERHHKPYALD
LTPALKRNALRVAEIWMDEHKHMVYLAWNIPLQDSGIDFGDISSRMALRKKLKCKTFDWY
LKNVYPLLKPIHTIVGYGRMKNLLDENVCLDQGPIPGNTPIMYYCHEFSSQNVYYHLTGE
LYVGQLIAEASASDRCLTDPGKAEKPTLEPCSKAAKNGLHIYWDFKPGGAVINRDTKRCL
EMKKDLSGSHVLVLQTCTTQVWEIQHTVRDWGHTNSQ
Download sequence
Identical sequences H2NG67
ENSPPYP00000004756 XP_009245618.1.23681 ENSPPYP00000004756 9600.ENSPPYP00000004756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]