SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004806 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004806
Domain Number 1 Region: 425-682
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.33e-73
Family Eukaryotic proteases 0.000000000723
Further Details:      
 
Domain Number 2 Region: 19-131
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-30
Family Spermadhesin, CUB domain 0.000000414
Further Details:      
 
Domain Number 3 Region: 174-287
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-24
Family Spermadhesin, CUB domain 0.0000676
Further Details:      
 
Domain Number 4 Region: 359-429
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000653
Family Complement control module/SCR domain 0.000011
Further Details:      
 
Domain Number 5 Region: 298-362
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000931
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 6 Region: 127-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000571
Family EGF-type module 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004806   Gene: ENSPPYG00000004217   Transcript: ENSPPYT00000004996
Sequence length 688
Comment pep:known chromosome:PPYG2:12:7295050:7305811:1 gene:ENSPPYG00000004217 transcript:ENSPPYT00000004996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCIVLFSLLAWVYAEPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIE
LSENCAYDSVQIISGDIEEGRLCGQRSSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERF
TGFAAYYVATDINECTDFVDAPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGDVF
TALIGEIASPNYPKPYPENSRCEYQIRLEKGFQVVVTVRREDFDVEPADSEGNCLDSLVF
VAGDQQFGPYCGHGFPGPLNIETKSNALDIIFQTDLTGQKKGWKLRYHGDPMPCPKEDTP
NSVWEPAKAKYVFRDVVQITCLDGFEVVEGRVGATSFYSTCQSNGKWSNSKLKCQPVDCG
IPESIENGKVEDPESTLFGSVIHYTCEEPYYYMENGGGGEYHCAGNGSWVNEVLGPELPK
CVPVCGVPREPFEEKQRIIGGSDADIKNFPWQVFFDNPWAGGALIDEYWVLTAAHVVEGN
REPTMYVGSTSVQTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVK
MGPTVSPICLPGTSSDYNLVDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKV
EKPTADAEAYVFTPNMICAGGEKGMDSCKGDSGGAFAVQDPNDKTKFYVAGLVSWGPQCG
TYGLYTRVKNYIDWIMKTMQENSTPRED
Download sequence
Identical sequences H2NGB6
9600.ENSPPYP00000004806 ENSPPYP00000004806 XP_002822888.1.23681 XP_002822889.1.23681 ENSPPYP00000004806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]