SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004809 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004809
Domain Number 1 Region: 441-666
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.31e-56
Family Eukaryotic proteases 0.00000000986
Further Details:      
 
Domain Number 2 Region: 23-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-30
Family Spermadhesin, CUB domain 0.0001
Further Details:      
 
Domain Number 3 Region: 192-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-27
Family Spermadhesin, CUB domain 0.000043
Further Details:      
 
Domain Number 4 Region: 308-379
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000556
Family Complement control module/SCR domain 0.0000103
Further Details:      
 
Domain Number 5 Region: 138-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000838
Family EGF-type module 0.00025
Further Details:      
 
Domain Number 6 Region: 376-449
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000135
Family Complement control module/SCR domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004809   Gene: ENSPPYG00000004218   Transcript: ENSPPYT00000004999
Sequence length 670
Comment pep:known_by_projection chromosome:PPYG2:12:7314924:7354740:-1 gene:ENSPPYG00000004218 transcript:ENSPPYT00000004999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLLYLLVPAMFCRAGGSIPIPQKLFGEVTSPLFPKPYPNNFETTTVITVPTGYRVKLVF
QQFDLEPSEGCFYDYVKISADKKSLGRFCGQLGSPLGNPPGKKEFMSQGNKMLLTFHTDF
SNEENGTIMFYKGFLAYYQAVDLDECASQSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGY
ELQKDRHSCQAECSSELYTEASGYISSLEYPRSYPPDLRCNYSIRVERGLTLHLKFLEPF
EIDDHQQVHCPYDQLQIYANGKNIGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWNL
RYTTEIIKCPQPKTLDEFTIIQNLQPQYQFRDYFIATCKQGYQLIEGNQVLHSFTAVCQD
DGTWHRAMPRCKIKDCGQPRNLPNASEHLTFFPSRVEPLTFGPCHVGSSLPLSPSSTLRV
YTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPWQEHEAQTNA
SLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESHNFEGDIALLELENSVTLGPNLLP
ICLPDNETFYDLGLMGYVSGFGVMEEKIAHDLRFVRLPVANPQACETWLRGKNRMDVFSQ
NMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVD
WIKKEMEEED
Download sequence
Identical sequences H2NGB9
ENSPPYP00000004809 ENSPPYP00000004809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]