SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004811 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004811
Domain Number 1 Region: 212-467
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.41e-63
Family Eukaryotic proteases 0.00000012
Further Details:      
 
Domain Number 2 Region: 30-147
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-23
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000004811
Domain Number - Region: 174-219
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000481
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004811   Gene: ENSPPYG00000004220   Transcript: ENSPPYT00000005001
Sequence length 471
Comment pep:known_by_projection chromosome:PPYG2:12:7361392:7376200:-1 gene:ENSPPYG00000004220 transcript:ENSPPYT00000005001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPRVWGWWLLLWGVLQACPTRGSVLLAQELPQQLTSPGYPEPYRKGQESSTDIKAPEG
FAVRLVFQDFDLEPSQDCAGDSVTISAGGLDPSQFCGQQGSPLGRPPGQREFISSGRSLR
LTFCTQPSSENKTAHLHKGFLALYQTVAVNYSQPVSEASRGSEAINAPGDNPAKVQNHCQ
EPYYQAAAAGALTCATPGTWKDGQDGGEVLQCMPVCGRPVTQIAQNQTTLGSSRAKLGNF
PWQAFTSIHGRGGGALLGDRWILTAAHTIYPKDSVSLRKNQSVNVFLGHTAIDEMLKLGN
HPVHRVVVHPDYRQNESHNFSGDIALLELQHSIPLGPNVLPVCLPDNETLYRSGLLGYVS
GFGMEMGWLTTELKYSRLPVAPREACNAWLQKRQRPEVFSDNMFCVGDETQRHSVCQGDS
GSVYVVWDDHAHHWVATGIVSWGIGCGEGYDFYTKVLSYVDWIKGVMNGKN
Download sequence
Identical sequences H2NGC1
ENSPPYP00000004811 9600.ENSPPYP00000004811 ENSPPYP00000004811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]