SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004824 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004824
Domain Number 1 Region: 69-211
Classification Level Classification E-value
Superfamily C-type lectin-like 9.62e-40
Family C-type lectin domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004824   Gene: ENSPPYG00000004231   Transcript: ENSPPYT00000005014
Sequence length 213
Comment pep:known_by_projection chromosome:PPYG2:12:8073121:8091276:-1 gene:ENSPPYG00000004231 transcript:ENSPPYT00000005014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPEEEPQDREKGFWWFQLKVWSVAVVSILLLSVCFTVSCVVTHNFICSKTVERLSKLRE
CQQYHPSLTCVVEGKDIEDWSCCPTPWTSFQSSCYFISTVMQSWTKSQKNCSVMGADLVV
INTKEEQDFIIQNLKRNSSYFLGLSDPEGRRHWQWVDQTPYNENVTFWHRGEPNNLDERC
AIINFRSLEEWGWNDVHCHVPQKSICKMKKIYI
Download sequence
Identical sequences H2NGD4
XP_003778006.1.23681 9600.ENSPPYP00000004824 ENSPPYP00000004824 ENSPPYP00000004824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]