SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004835 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004835
Domain Number 1 Region: 66-234
Classification Level Classification E-value
Superfamily C-type lectin-like 1.59e-40
Family C-type lectin domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004835   Gene: ENSPPYG00000004239   Transcript: ENSPPYT00000005025
Sequence length 237
Comment pep:known_by_projection chromosome:PPYG2:12:8451171:8466200:1 gene:ENSPPYG00000004239 transcript:ENSPPYT00000005025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSEITYAEVRFKNEFKSSGINSASSAASKERTAPHKSNTGFPKLLCASLLILFLLLAIS
FFIAFVIFFQKYSQLLEKKTTKELVHTTLECVKKNMPMEETAWSCCPKNWKSFSSNCYFI
STESASWQDSEKDCARMEAHLLVINTQEEQEFIFQNLQEESAYFVGLSDPEGQRHWQWVD
QTPYNESSTFWHQHEPSDPNERCVVLNFRKVPKRWGWNDVNCLGPQRSVCEMMKIHL
Download sequence
Identical sequences H2NGE4
9600.ENSPPYP00000004835 ENSPPYP00000004835 ENSPPYP00000004835 XP_002822910.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]