SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004836 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004836
Domain Number 1 Region: 35-205
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-39
Family C-type lectin domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004836   Gene: ENSPPYG00000004240   Transcript: ENSPPYT00000005026
Sequence length 208
Comment pep:known_by_projection chromosome:PPYG2:12:8510808:8533113:1 gene:ENSPPYG00000004240 transcript:ENSPPYT00000005026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQEQQPQGTEKRGWWSLRLWSVAGISIALLSACFIVSCVVTYHFTYGETGKRLSELHSY
SSLTCFSEGTKVPAWGCCPASWKSFGSSCYFISSEEKVWSKSEQNCVKMGAHLVVFNTEA
EQNFIVQQLNESFSYFLGLSDPQGNNNWQWIDKTPYEKNVRFWHLGEPNHSAEQCASIVF
WKPAGWGWNDVICETRRNSICEMNKIYL
Download sequence
Identical sequences H2NGE5
9600.ENSPPYP00000004836 XP_002822911.1.23681 ENSPPYP00000004836 ENSPPYP00000004836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]