SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004841 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004841
Domain Number 1 Region: 809-1107
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 4.55e-89
Family Complement components 0.0000197
Further Details:      
 
Domain Number 2 Region: 1180-1276
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 2.35e-19
Family Alpha-macroglobulin receptor domain 0.00059
Further Details:      
 
Domain Number 3 Region: 688-758
Classification Level Classification E-value
Superfamily E set domains 0.00000000000574
Family SVA-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004841   Gene: ENSPPYG00000004245   Transcript: ENSPPYT00000005031
Sequence length 1277
Comment pep:known_by_projection chromosome:PPYG2:12:8861851:8915919:1 gene:ENSPPYG00000004245 transcript:ENSPPYT00000005031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAQLLLGTLALSLAIAEELPNYLVTLPARLNFPSVQKVCLDLSPGYCDVKFTVTLETKD
KTQKLLEHSGLKKRHLHCISFLVPPPAGGTEEVATIGVSGVGNNISFEEKKKVLIQRQGS
GTFVQTDKPVYTPGQQYSMVELQDPNSNRIAQWLEVVPEQGIVDLSFQLAPEAMLGTYTV
AVAEGKTFGTFSVEEYVLPKFKVEVVEPKELSTVQESFLVKICCRYTYGKPMLGAVQVSV
CQKANTYWYREVEQEQLPDKCRNLSGQTDKTGCFSAPVDMATFDLIGYAYSHQISIVATV
VEEGTGVEANATQNIYISPQMGSMTFEDTSNFYHPNFPFSGKIRVRGHDDSLLKNHLVFL
VIYGTNGTFNQTLVTDNNGLAPFTLETSSWNGTDVSLEGKFQMEDLVYNPEQVPRYYQNA
YLHLQPFYNTTRSFLGIHRLNGPLKCGQPQEVLVDYYIDPADASPDQEISFSYYLIGKGS
LVMEGQKHLNSKKKGLKGSFSLSLTFTSRLAPDPSLVIYTIFPSGGVVADKIQFSVEMCF
DNQVYRMFPFWYGHYPYQVAEYDQCPVSGPWDFPQPLIDPVPQGHSSQHSVIWRPWFSEG
TDLFSFFRDMGLKILSNAKIKKPVDCSHRSPEYSTAMGAGGGHPEAFESSTSSHRAEDSQ
VRQYFPETWLWDLFPIVQTDLDKGEYQLESWADSQTSSCLCADEAKSYHWNITAVKLGHI
NFTISTNILDSNEPCGGQKGFVPQKGRSDTLIKPVLVKPEGVLVEKTHSSLLCPKGKVAS
ESVSLELPMDIVPDSTKAYVSVLGDIMGTALQNLDGLVQMPSGCGEQNMVLFAPIIYVLQ
YLEKAGLLTEEIRSRAVGFLEIGYQKELMYKHSNGSYSAFGERDRNGNTWLTAFVTKCFG
QAQKFIFIDPKNIQDALKWMAGNQLPSGCYANVGNLLHTAMKGGVDDEVSLTAYVTAALL
EMGMEIDDPMVSQGLQCLKNSATSTTNLYTQALLAYIFSLAGEMDIRNFLLKQLDQQAII
SGESIHWSQKPTPSSNASPWSEPAAVDVELTAYALLAQLTKPSLTQKEIAKATSIVAWLS
KQRNAYGGFSSTQDTVVALQALAKYATTAYRPSEEINLVVKSTENFQRTFNIQSVNRLVF
QKETLPNVPGMYTLEASGQGCVYVQTVLRYNILPPKNMTTFSLSVEIGKDRCEQPTSPRS
LTLTIHTLLQQPLVKKVEFGTDTLNIYLDELIKNTQTYTFTISQSVLVTNLKPATIKVYD
YYLPDEQATIQYSDPCE
Download sequence
Identical sequences H2NGF0
ENSPPYP00000004841 9600.ENSPPYP00000004841 ENSPPYP00000004841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]