SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004846 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004846
Domain Number 1 Region: 35-156
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-19
Family C-type lectin domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004846   Gene: ENSPPYG00000004248   Transcript: ENSPPYT00000005036
Sequence length 164
Comment pep:known_by_projection chromosome:PPYG2:12:9039821:9052075:1 gene:ENSPPYG00000004248 transcript:ENSPPYT00000005036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLVSVLLYQWIL
CQGSNYSTCASCPSCPDHWMKYGNHCYYFSVEKKDWNSSLEFCLARDSHLLVITDNQEML
NFSRISSNSLVQTCGAINKYGLQASSCEVPLQWVCKPFADQALF
Download sequence
Identical sequences H2NGF5
ENSPPYP00000004846 9600.ENSPPYP00000004846 ENSPPYP00000004846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]