SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004852 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004852
Domain Number 1 Region: 39-188
Classification Level Classification E-value
Superfamily C-type lectin-like 1.52e-32
Family C-type lectin domain 0.0000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004852   Gene: ENSPPYG00000004254   Transcript: ENSPPYT00000005043
Sequence length 191
Comment pep:novel chromosome:PPYG2:12:9777694:9803245:-1 gene:ENSPPYG00000004254 transcript:ENSPPYT00000005043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHDRNNVEKDIAPSELPANPGYLHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIR
ANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELN
FLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQFPILGAGECAYLNDKGASSARHYTER
KWICSKSDIHV
Download sequence
Identical sequences H2NGG1
ENSPPYP00000004852 ENSPPYP00000004852 XP_003778011.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]