SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004855 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004855
Domain Number 1 Region: 48-216
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-29
Family C-type lectin domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004855   Gene: ENSPPYG00000004256   Transcript: ENSPPYT00000005046
Sequence length 225
Comment pep:known_by_projection chromosome:PPYG2:12:9867339:9886512:1 gene:ENSPPYG00000004256 transcript:ENSPPYT00000005046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQQAIYAELNLPTDSGPESSSPSSLPRDVCQGSPWHQFALKLSCAGIILLALVVTGLSV
SVTSLIQKSSIEKCSADIQQNRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLA
DCSTKESSLLLIRDKDELTRTQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEI
RGDAKENSCIYISQTSVYSEYCSTEIRWICQKELTPVRNKVYPDS
Download sequence
Identical sequences H2NGG4
ENSPPYP00000004855 ENSPPYP00000004855 XP_002822929.1.23681 9600.ENSPPYP00000004855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]