SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004856 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004856
Domain Number 1 Region: 33-184
Classification Level Classification E-value
Superfamily C-type lectin-like 1.99e-35
Family C-type lectin domain 0.00000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004856   Gene: ENSPPYG00000004257   Transcript: ENSPPYT00000005047
Sequence length 185
Comment pep:known_by_projection chromosome:PPYG2:12:10005494:10119499:-1 gene:ENSPPYG00000004257 transcript:ENSPPYT00000005047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELHLPNHDATSPHFSTRHEGSFQVPVLCAIMNVVFITILIIALIALSVGQYNCPGQYTF
SMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKR
YTGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSEKCVFLKNTEVSSMECEKNLYWIC
NKPYK
Download sequence
Identical sequences H2NGG5
ENSPPYP00000004856 ENSPPYP00000004856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]