SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004857 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004857
Domain Number 1 Region: 108-231
Classification Level Classification E-value
Superfamily C-type lectin-like 6.12e-34
Family C-type lectin domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004857   Gene: ENSPPYG00000004258   Transcript: ENSPPYT00000005048
Sequence length 231
Comment pep:known_by_projection chromosome:PPYG2:12:10076028:10093417:1 gene:ENSPPYG00000004258 transcript:ENSPPYT00000005048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDEERYMTLNVQSKKRSSAQTSQLTFKDYSVMLHRYKILLGISGTVNGILALTLISLIL
LVSQGVLLKCQKGSYSNTTEYEDIGDLKVNNGTRRNISNKDLCVSRSADQTVLCQSEWLK
YQGKCYWFSNEMKSWSDSYVYCLERKSHLLIIHDQLEMAFIEKNVRQSNYVWIGLNFTSL
KMTWTWVDGSPVDSKIFFIKGPAKENSCAAIKESKIYSETCSSVFKWICQY
Download sequence
Identical sequences H2NGG6
ENSPPYP00000004857 ENSPPYP00000004857 9600.ENSPPYP00000004857 XP_002822935.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]